EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
Demon-S-Layer - Comic
Demon-S-Layer - Comic
Demon-S-Layer - Comic
Demon-S-Layer - Comic
Demon-S-Layer - Comic
Demon-S-Layer - Comic
Product Code:TxTdXEN
weight:221.0g
Product Condition:New
21,99 € inc. tax
Add to Cart
Description
-40 PAGES-
A Templar is looking for a Demon that seems to be corrupting the land, she will find it, but it won't be what she's expecting.

Size: 27,5 x 18,5cm
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
write review
Very happy, this is the best thing I've bought from here!
Tuesday, July 13, 2021
Unlike the little red comic, this one has enough pages to give it a proper spine, making it seem more like a proper book. I'm thriled to own a physical copy, I absolutely love this and can't wait for all future releases!
Tyler Norman
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Hosted online store
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
10+ years
650k stores created
No card required
Easy to create
What's the catch?
No catch
0% commission
Free forever!
Feature upgrades available
Get Started
i